PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00011449-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 347aa    MW: 37621.1 Da    PI: 6.7932
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00011449-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.9e-14104148347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ l++ + ++lG+g+W+ Iar + + Rt+ q+ s+ qky
  WALNUT_00011449-RA 104 PWTEEEHRLFLVGLQKLGKGDWRGIARNFVTSRTPTQVASHAQKY 148
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.103.0E-4228IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.515320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.44297153IPR017930Myb domain
SuperFamilySSF466892.15E-1799154IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-18100152IPR006447Myb domain, plants
SMARTSM007171.5E-11101151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-12101147IPR009057Homeodomain-like
PfamPF002491.3E-11104148IPR001005SANT/Myb domain
CDDcd001675.62E-10104149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPN RGGAGGCVKL FGVKLTDGSI IKKSASMGNL SAHYHSSSSA  60
AASPNYQDSP TSDPVHVSDG YLSDDPAHAS CSANRRGDRK KGVPWTEEEH RLFLVGLQKL  120
GKGDWRGIAR NFVTSRTPTQ VASHAQKYFI RQSNANRKKR RSSLFDMVPD TATDTPSVPE  180
EQVLLSSAQL RATDTANLLP SLNLSLNSEF EPMEATPQEE VEELNESVAG STGLAPMIPQ  240
FFPAYLPLPF PIWPPNTDLM EEEKGAESSY HQVLKPIPIL PKHPVNVDEL VGMSQLSLGE  300
AERGHREPSP LSLKLIGEPS RQSAFHANAS VSGSDLNKGE SSVIEAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902398.11e-178PREDICTED: uncharacterized protein LOC107435329
RefseqXP_015902404.11e-178PREDICTED: uncharacterized protein LOC107435334
TrEMBLA0A0B2RLB01e-171A0A0B2RLB0_GLYSO; Transcription factor MYB1R1
TrEMBLA0A0R4J5531e-171A0A0R4J553_SOYBN; Uncharacterized protein
STRINGGLYMA13G43120.11e-170(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-108MYB_related family protein